RDH7_MOUSE   O88451


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88451

Recommended name:Retinol dehydrogenase 7

EC number:EC 1.1.1.105

Alternative names:(Cis-retinol/3alpha-hydroxysterol short-chain dehydrogenase isozyme 2) (Cis-retinol/androgen dehydrogenase type 2) (CRAD-2)

Cleaved into:

GeneID:54150

Gene names  (primary ):Rdh7

Gene names  (synonym ):Crad2

Gene names  (ORF ):

Length:316

Mass:35660

Sequence:MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRNKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGICVFAINEWLKKEDFANILDVNLLGMIEVTLSMLPLVRKARGRVVNISSSMGRVSLCGGGYCISKYGVEAFSDSLRREISYFGVKVAIIEPGGFRTNVSNYERLSHSIEKLWDQTSSEVKEVYDKNFLDSYIKAIQSLTDTCSDDLSVVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYMPTFLVDAMLYWSSVKPAQAL

Tissue specificity:Highly expressed in liver. Also expressed in lung, eye, kidney, and brain. {ECO:0000269|PubMed:9651397}.

Induction:

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family


   💬 WhatsApp