NOG1_MOUSE   Q99ME9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99ME9

Recommended name:Nucleolar GTP-binding protein 1

EC number:

Alternative names:(Chronic renal failure gene protein) (GTP-binding protein NGB)

Cleaved into:

GeneID:69237

Gene names  (primary ):Gtpbp4

Gene names  (synonym ):Crfg Nog1

Gene names  (ORF ):

Length:634

Mass:74113

Sequence:MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQRQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLKEQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEEDQKIFLDLQAEGFPVIETSTLTEEGVIQVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVIARRKRMEIEEPKKKRERDLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNVADYIDPAIMKKLEELEKEEELRTAAGEYDSDSESEDEEMMEIRQLAKQIREKKKLKILQSKEKNKQGPRMPRTAKKVQRADLENEMRSLGVDMDDKNNAHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSRTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Tissue specificity:Ubiquitous.

Induction:

Developmental stage:

Protein families:TRAFAC class OBG-HflX-like GTPase superfamily, OBG GTPase family, NOG subfamily


   💬 WhatsApp