CHMP3_MOUSE   Q9CQ10


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ10

Recommended name:Charged multivesicular body protein 3

EC number:

Alternative names:(Chromatin-modifying protein 3) (Vacuolar protein sorting-associated protein 24)

Cleaved into:

GeneID:66700

Gene names  (primary ):Chmp3

Gene names  (synonym ):Vps24

Gene names  (ORF ):

Length:224

Mass:25219

Sequence:MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGAMAASEEGEEEEDEEDLEAMQSRLATLRS

Tissue specificity:Expressed in lung, testis, heart, spleen, skeletal muscle, kidney, liver and brain. {ECO:0000269|PubMed:17331679}.

Induction:

Developmental stage:

Protein families:SNF7 family


   💬 WhatsApp