CHM1A_MOUSE   Q921W0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q921W0

Recommended name:Charged multivesicular body protein 1a

EC number:

Alternative names:(Chromatin-modifying protein 1a) (CHMP1a)

Cleaved into:

GeneID:234852

Gene names  (primary ):Chmp1a

Gene names  (synonym ):Chmp1 Pcoln3

Gene names  (ORF ):

Length:196

Mass:21608

Sequence:MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSVMEDSVSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN

Tissue specificity:Highly expressed in adult heart, kidney and liver. Expressed at lower levels in adult colon, spleen, lung, brain, testis and muscle. Also expressed in myoblasts and embryo fibroblasts. {ECO:0000269|PubMed:11559747}.

Induction:

Developmental stage:

Protein families:SNF7 family


   💬 WhatsApp