C97D2_MOUSE G3UW36
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:G3UW36
Recommended name:Uncharacterized protein CFAP97D2
EC number:
Alternative names:(CFAP97 domain-containing protein 2)
Cleaved into:
GeneID:403185
Gene names (primary ):Cfap97d2
Gene names (synonym ):
Gene names (ORF ):
Length:98
Mass:11800
Sequence:MHRVPRLTTPWANRDLQRAWEKTYQDHRKKVQNAQPLVDTHPPQIYSHLCLKFKKLKMEEERLSIIDRNNYLLLQRVASAMKTRGQTDGRNNFTQRRS
Tissue specificity:Expressed in a number of tissues including brain, thymus, lung, heart, liver, spleen, kidney and testis. {ECO:0000269|PubMed:32785227}.
Induction:
Developmental stage:
Protein families:CFAP97 family