CERS4_MOUSE Q9D6J1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D6J1
Recommended name：Ceramide synthase 4
EC number：EC 2.3.1.-
Alternative names：(CerS4) (LAG1 longevity assurance homolog 4) (Sphingosine N-acyltransferase CERS4) (Translocating chain-associating membrane protein homolog 1) (TRAM homolog 1)
Cleaved into：
GeneID：67260
Gene names (primary )：Cers4
Gene names (synonym )：Lass4 Trh1
Gene names (ORF )：
Length：393
Mass：46017
Sequence：MSFSLSEWLWQETYWLPPNVTWAELEDRDGLVFAHPHHVLAAFPVALVLVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEETQMVLLASQCGLTLRQTQRWFRRRRNQDRPSLSKKFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLYWWYLLELGFYLSLLITLPFDVKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHDCSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLIFFPTQVIYTSVYDSIKNSGPFFGYYFFIVLLVMLQILHVYWFCLILRMLYSFLHKGQMTEDIRSDVEEPDSSDDEPVSEGPQLKNGMARGSRVAVTNGPRSRAAACLTNGHTRAT
Tissue specificity：Ubiquitously expressed, with highest levels in skin. {ECO:0000269|PubMed:12912983, ECO:0000269|PubMed:15823095}.
Induction：
Developmental stage：
Protein families：