CEP41_MOUSE   Q99NF3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99NF3

Recommended name:Centrosomal protein of 41 kDa

EC number:

Alternative names:(Cep41) (Testis-specific gene A14 protein)

Cleaved into:

GeneID:83922

Gene names  (primary ):Cep41

Gene names  (synonym ):Tsga14

Gene names  (ORF ):

Length:373

Mass:41442

Sequence:MSARRHIGNPEYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEADAEIAAKTNGKGSPEEQSPSPVQFINSTGAGDSSRSTLQSVISGVGELDVDKGLVKKEEPNGKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDEDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLVTGSLPASCQQALPFGSVRKRRGPKMPALPAENKWRFTPEDLKKIECYLEEDQGPADNPSRLNQNNSAGKDSKVAACRGGQNLPTSCPASHSSPRTLTSGHLQGKPWK

Tissue specificity:

Induction:

Developmental stage:

Protein families:CEP41 family


   💬 WhatsApp