CETN4_MOUSE Q8K4K1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4K1
Recommended name：Centrin-4
EC number：
Alternative names：(Centrin4)
Cleaved into：
GeneID：207175
Gene names (primary )：Cetn4
Gene names (synonym )：Cen4
Gene names (ORF )：
Length：168
Mass：19200
Sequence：MASSQRITLDQWKKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLIAEIDKEGTGTICFEDFFAIMSVKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENLTEDELQEMLDEADRDGDGEINEEEFLKMMKKTSLY
Tissue specificity：In brain, specifically expressed in ciliated cells. In retina, expression is localized to the connecting cilium and basal body of photoreceptors (at protein level). Highly expressed in brain, kidney, lung, retina and ovary, and weakly expressed in spleen. Not detected in testis, colon, stomach, thymus, skeletal muscle, heart, intestine or liver. {ECO:0000269|PubMed:12802058, ECO:0000269|PubMed:15347651}.
Induction：
Developmental stage：
Protein families：Centrin family