CENPK_MOUSE   Q9ESN5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ESN5

Recommended name:Centromere protein K

EC number:

Alternative names:(CENP-K) (SoxLZ/Sox6 leucine zipper-binding protein in testis)

Cleaved into:

GeneID:60411

Gene names  (primary ):Cenpk

Gene names  (synonym ):Solt

Gene names  (ORF ):

Length:271

Mass:31686

Sequence:MSENKQEVHPDTITDVEAVIDTEEELIKECEEMWKDMEDCQNKLSLIGTETLTNADAQLSLLIMQMKCLTAELGQWKKRKPEIIPLNEDVLLTLGKEEFQKLRCDLEMVLSTIQSKNEKLKEDLEREQQWLDEQQQILDTLNVLNSDVENQVVTLTESRIFNELTTKIRGIKEFKEKLLLTLGAFLDNHFPLPEASTPKKRKNIQDSNAQLITLNEILEMLINRMFDVPHDPYVKIRDSFWPPYIELLLRYGIALRHPEDPSQIRLEAFHQ

Tissue specificity:Highly expressed in testis. {ECO:0000269|PubMed:10996314}.

Induction:

Developmental stage:

Protein families:CENP-K/MCM22 family


   💬 WhatsApp