RET2_MOUSE   Q08652


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q08652

Recommended name:Retinol-binding protein 2

EC number:

Alternative names:(Cellular retinol-binding protein II) (CRBP-II)

Cleaved into:

GeneID:19660

Gene names  (primary ):Rbp2

Gene names  (synonym ):Crbpii

Gene names  (ORF ):

Length:134

Mass:15610

Sequence:MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIITQDGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRHVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCRQVFKKK

Tissue specificity:Expressed in prenatal liver, intestine and lung, and in adult intestine.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Fatty-acid binding protein (FABP) family


   💬 WhatsApp