RET7_MOUSE   Q9EPC5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EPC5

Recommended name:Retinoid-binding protein 7

EC number:

Alternative names:(Cellular retinoic acid-binding protein 4) (CRABP4) (CRBP4) (Cellular retinoic acid-binding protein IV) (CRABP-IV)

Cleaved into:

GeneID:63954

Gene names  (primary ):Rbp7

Gene names  (synonym ):

Gene names  (ORF ):

Length:134

Mass:15428

Sequence:MPADLSGTWNLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIQTCSSLRNYLVKFKVGEEFEEDNKGLDNRKCTSLVTWENDKLTCVQRGEKKNRGWSHWIEGDQLHLEMFCEGQVCKQTFQRA

Tissue specificity:Highly expressed in white adipose tissue and mammary gland.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Fatty-acid binding protein (FABP) family


   💬 WhatsApp