TACD2_MOUSE Q8BGV3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGV3
Recommended name：Tumor-associated calcium signal transducer 2
EC number：
Alternative names：(Cell surface glycoprotein Trop-2)
Cleaved into：
GeneID：56753
Gene names (primary )：Tacstd2
Gene names (synonym )：Trop2
Gene names (ORF )：
Length：317
Mass：35574
Sequence：MARGLDLAPLLLLLLAMATRFCTAQSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAGVIAVIAVVSVAVVAGVVVLVVTKRRKSGKYKKVELKELGEMRSEPSL
Tissue specificity：Expressed in kidney, lung, ovary and testis. High levels of expression in immortalized keratinocytes. {ECO:0000269|PubMed:9462726}.
Induction：
Developmental stage：
Protein families：EPCAM family