GULP1_MOUSE   Q8K2A1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K2A1

Recommended name:PTB domain-containing engulfment adapter protein 1

EC number:

Alternative names:(Cell death protein 6 homolog) (PTB domain adapter protein CED-6) (Protein GULP)

Cleaved into:

GeneID:70676

Gene names  (primary ):Gulp1

Gene names  (synonym ):Ced6

Gene names  (ORF ):

Length:304

Mass:34470

Sequence:MNRAFSRKKDKTWMHTPEALSKHYIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCFVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGMQKRIQDLETENMELKNKVQDLESRLRTTQVSTSPAHGVTVMSPSTDIFDMIPFSPISHQSPTSARNGTQLPPIPSRSAETKRDLFGAEPFDPFNCGSGDFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPLDSRC

Tissue specificity:Detected throughout the brain, particularly in Purkinje cells, hippocampal and cortical neurons (at protein level). {ECO:0000269|PubMed:17007823}.

Induction:

Developmental stage:

Protein families:Ced-6 family


   💬 WhatsApp