CD5R2_MOUSE O35926
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35926
Recommended name：Cyclin-dependent kinase 5 activator 2
EC number：
Alternative names：(CDK5 activator 2) (Cyclin-dependent kinase 5 regulatory subunit 2) (p39) (p39I)
Cleaved into：
GeneID：12570
Gene names (primary )：Cdk5r2
Gene names (synonym )：Nck5ai
Gene names (ORF )：
Length：369
Mass：38924
Sequence：MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDGPDGGGTAKPLAVPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASTGGPPSGSSASTTSSSSARDSCATGAKHWTMNLDR
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cyclin-dependent kinase 5 activator family