TNFL8_MOUSE   P32972


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P32972

Recommended name:Tumor necrosis factor ligand superfamily member 8

EC number:

Alternative names:(CD30 ligand) (CD30-L) (CD antigen CD153)

Cleaved into:

GeneID:21949

Gene names  (primary ):Tnfsf8

Gene names  (synonym ):Cd30l Cd30lg

Gene names  (ORF ):

Length:239

Mass:26519

Sequence:MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tumor necrosis factor family


   💬 WhatsApp