CD27_MOUSE P41272
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P41272
Recommended name：CD27 antigen
EC number：
Alternative names：(CD27L receptor) (T-cell activation antigen CD27) (Tumor necrosis factor receptor superfamily member 7) (CD antigen CD27)
Cleaved into：
GeneID：21940
Gene names (primary )：Cd27
Gene names (synonym )：Tnfrsf7
Gene names (ORF )：
Length：250
Mass：28164
Sequence：MAWPPPYWLCMLGTLVGLSATLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP
Tissue specificity：In thymus and spleen, but not in non-lymphoid tissues.
Induction：
Developmental stage：
Protein families：