MO2R5_MOUSE   Q8BTP3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BTP3

Recommended name:Cell surface glycoprotein CD200 receptor 5

EC number:

Alternative names:(CD200 cell surface glycoprotein receptor-like 5) (CD200 receptor-like 5) (CD200 cell surface glycoprotein receptor-like e) (CD200RLe) (Cell surface glycoprotein OX2 receptor 5)

Cleaved into:

GeneID:319823

Gene names  (primary ):Cd200r5

Gene names  (synonym ):

Gene names  (ORF ):

Length:270

Mass:29528

Sequence:MHALGRTPALTLLIFINIFVSGSRCTDKNQTIQNDSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRDLPSCTILYKVDTKTIETSCLDRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFGRVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSAVSCIVSHSTGNKSLFIELNQGSTTTTTSLLTILYVKMVLLGIILLHVGFAFFQKRNVIRT

Tissue specificity:

Induction:

Developmental stage:

Protein families:CD200R family


   💬 WhatsApp