M4A6D_MOUSE Q99N07
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N07
Recommended name：Membrane-spanning 4-domains subfamily A member 6D
EC number：
Alternative names：(CD20 antigen-like 8)
Cleaved into：
GeneID：68774
Gene names (primary )：Ms4a6d
Gene names (synonym )：Cd20l8 Ms4a11
Gene names (ORF )：
Length：247
Mass：26383
Sequence：MIPQVVTSETVTVISPNGISFPQTDKPQPSHQSQDSLKKHLKAEIKVMAAIQIMCAVMVLSLGIILASVPSNLHFTSVFSILLESGYPFVGALFFAISGILSIVTEKKMTKPLVHSSLALSILSVLSALTGIAILSVSLAALEPALQQCKLAFTQLDTTQDAYHFFSPEPLNSCFVAKAALTGVFSLMLISSVLELGLAVLTATLWWKQSSSAFSGNVIFLSQNSKNKSSVSSESLCNPTYENILTS
Tissue specificity：Expressed in thymus, spleen, intestine, colon, testis, heart, liver, brain, kidney, peripheral lymph node and bone marrow.
Induction：
Developmental stage：
Protein families：MS4A family