M4A8_MOUSE   Q99N10


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99N10

Recommended name:Membrane-spanning 4-domains subfamily A member 8

EC number:

Alternative names:(CD20 antigen-like 5) (Membrane-spanning 4-domains subfamily A member 8A)

Cleaved into:

GeneID:64381

Gene names  (primary ):Ms4a8

Gene names  (synonym ):Cd20l5 Ms4a8a

Gene names  (ORF ):

Length:290

Mass:30858

Sequence:MNRPTAQGAVNLSGSKFSTAKSWEPEQERLTWQPGTVSMNTVTSPGPMANSVYVVAPPNSYPVVPGTVPQMPIYPSNQPQVHVISGHLPGLVPAMTEPPAQRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSHYTPVSLYGGFPFWGGIWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIMLFITDISISSGYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVSSHFGCQVACCHYNNPGVVIPNVYAANPVVIPEPPNPIPSYSEVVQDSR

Tissue specificity:Expressed strongly in intestine and colon and minimally in lung and ovary. {ECO:0000269|PubMed:11245982}.

Induction:

Developmental stage:

Protein families:MS4A family


   💬 WhatsApp