M4A8_MOUSE Q99N10
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N10
Recommended name：Membrane-spanning 4-domains subfamily A member 8
EC number：
Alternative names：(CD20 antigen-like 5) (Membrane-spanning 4-domains subfamily A member 8A)
Cleaved into：
GeneID：64381
Gene names (primary )：Ms4a8
Gene names (synonym )：Cd20l5 Ms4a8a
Gene names (ORF )：
Length：290
Mass：30858
Sequence：MNRPTAQGAVNLSGSKFSTAKSWEPEQERLTWQPGTVSMNTVTSPGPMANSVYVVAPPNSYPVVPGTVPQMPIYPSNQPQVHVISGHLPGLVPAMTEPPAQRVLKKGQVLGAIQILIGLVHIGLGSIMITNLFSHYTPVSLYGGFPFWGGIWFIISGSLSVAAETQPNSPCLLNGSVGLNIFSAICSAVGIMLFITDISISSGYIYPSYYPYQENLGVRTGVAISSVLLIFCLLELSIASVSSHFGCQVACCHYNNPGVVIPNVYAANPVVIPEPPNPIPSYSEVVQDSR
Tissue specificity：Expressed strongly in intestine and colon and minimally in lung and ovary. {ECO:0000269|PubMed:11245982}.
Induction：
Developmental stage：
Protein families：MS4A family