IGLL1_MOUSE   P20764


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P20764

Recommended name:Immunoglobulin lambda-like polypeptide 1

EC number:

Alternative names:(CD179 antigen-like family member B) (Ig lambda-5) (CD antigen CD179b)

Cleaved into:

GeneID:16136

Gene names  (primary ):Igll1

Gene names  (synonym ):Igl-5

Gene names  (ORF ):

Length:209

Mass:22772

Sequence:MKLRVGQTLGTIPRQCEVLLLLLLLGLVDGVHHILSPSSAERSRAVGPGASVGSNRPSLWALPGRLLFQIIPRGAGPRCSPHRLPSKPQFWYVFGGGTQLTILGQPKSDPLVTLFLPSLKNLQANKATLVCLVSEFYPGTLVVDWKVDGVPVTQGVETTQPSKQTNNKYMVSSYLTLISDQWMPHSRYSCRVTHEGNTVEKSVSPAECS

Tissue specificity:Selectively expressed in pre-B lymphocytes. {ECO:0000269|PubMed:3024017}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp