KLRBC_MOUSE P27814
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27814
Recommended name:Killer cell lectin-like receptor subfamily B member 1C
EC number:
Alternative names:(CD161 antigen-like family member C) (Lymphocyte antigen 55c) (Ly-55c) (NK1.1) (NKR-P1.9) (NKR-P1C) (Natural killer cell surface protein P1-40) (NKR-P1 40) (CD antigen CD161c)
Cleaved into:
GeneID:17059
Gene names (primary ):Klrb1c
Gene names (synonym ):Ly55c Nkrp1c
Gene names (ORF ):
Length:223
Mass:25077
Sequence:MDTASIYLGLKPPRTLGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVLTLIGMSVLVRVLVQKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
Tissue specificity:Expressed in natural killer cells.
Induction:
Developmental stage:
Protein families: