CD9_MOUSE P40240
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40240
Recommended name：CD9 antigen
EC number：
Alternative names：(CD antigen CD9)
Cleaved into：
GeneID：12527
Gene names (primary )：Cd9
Gene names (synonym )：
Gene names (ORF )：
Length：226
Mass：25258
Sequence：MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Tissue specificity：Expressed predominantly in the peripheral nervous system (PubMed:14715942). Highly expressed in oocytes and blastocysts (at protein level) (PubMed:10518536, PubMed:10634790, PubMed:10634791, PubMed:23213457). Expression is also observed on follicular oocytes in the ovary, whereas no expression is found on follicular cells (at protein level) (PubMed:10518536, PubMed:10634790). Expressed in skeletal muscle mainly in endothelial cells of endomysial capillaries, in satellite cells and myoblasts (at protein level). {ECO:0000269|PubMed:10518536, ECO:0000269|PubMed:10634790, ECO:0000269|PubMed:10634791, ECO:0000269|PubMed:14715942, ECO:0000269|PubMed:23213457, ECO:0000269|PubMed:23575678}.
Induction：
Developmental stage：
Protein families：Tetraspanin (TM4SF) family