CD7_MOUSE P50283
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50283
Recommended name:T-cell antigen CD7
EC number:
Alternative names:(CD antigen CD7)
Cleaved into:
GeneID:12516
Gene names (primary ):Cd7
Gene names (synonym ):
Gene names (ORF ):
Length:210
Mass:23153
Sequence:MTQQAVLALLLTLAGILPGPLDAQDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPAAIAVGFFFTGLLLGVVCSMLRKIQIKKLCASGIKESPCVVYEDMSYSNRKTPCIPNQYQ
Tissue specificity:
Induction:
Developmental stage:
Protein families: