ACKR4_MOUSE Q924I3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924I3
Recommended name：Atypical chemokine receptor 4
EC number：
Alternative names：(C-C chemokine receptor type 11) (C-C CKR-11) (CC-CKR-11) (CCR-11) (CC chemokine receptor-like 1) (CCRL1) (CCX CKR)
Cleaved into：
GeneID：252837
Gene names (primary )：Ackr4
Gene names (synonym )：Ccr11 Ccrl1
Gene names (ORF )：
Length：350
Mass：39531
Sequence：MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLPAFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHGWILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWMAAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYASTARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRMDVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEGPTEPTSSFTI
Tissue specificity：Expressed in lung, heart, spleen, skeletal muscle, testis, astrocytes and microglia. Expressed by cortical thymic epithelial cells. {ECO:0000269|PubMed:11063828, ECO:0000269|PubMed:11981810, ECO:0000269|PubMed:23152546}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily