CBG_MOUSE   Q06770


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q06770

Recommended name:Corticosteroid-binding globulin

EC number:

Alternative names:(CBG) (Serpin A6) (Transcortin)

Cleaved into:

GeneID:12401

Gene names  (primary ):Serpina6

Gene names  (synonym ):Cbg

Gene names  (ORF ):

Length:397

Mass:44769

Sequence:MSLALYTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA

Tissue specificity:Expressed by the liver; secreted in plasma.

Induction:

Developmental stage:

Protein families:Serpin family


   💬 WhatsApp