CAMP_MOUSE   P51437


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51437

Recommended name:Cathelicidin antimicrobial peptide

EC number:

Alternative names:(Cathelin-like protein) (CLP)

Cleaved into:Cathelin-related antimicrobial peptide (Cramp)

GeneID:12796

Gene names  (primary ):Camp

Gene names  (synonym ):Cnlp Cramp

Gene names  (ORF ):

Length:172

Mass:19453

Sequence:MQFQRDVPSLWLWRSLSLLLLLGLGFSQTPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDPEPQGDEDPDTPKSVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

Tissue specificity:Expressed in testis, spleen, stomach, and intestine. Very low expression found in heart, lung and skeletal muscle. No expression in brain, kidney or liver.

Induction:

Developmental stage:

Protein families:Cathelicidin family


   💬 WhatsApp