T121B_MOUSE   Q99MX7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MX7

Recommended name:Transmembrane protein 121B

EC number:

Alternative names:(Cat eye syndrome critical region protein 6 homolog)

Cleaved into:

GeneID:94047

Gene names  (primary ):Tmem121b

Gene names  (synonym ):Cecr6

Gene names  (ORF ):

Length:572

Mass:58158

Sequence:MHPALGHPRALSSAPASFPPPPAAARLQPLFLRGGSSRGRRGSGDSSTSTSTSRGGCGGRRGGGGGSPSSSTGAEREDDDESISISKPLVPAAAALPGPPAQGGVPVSATAPAAASSTSTPTSSCSMTAADFGAGAAAGTVGGPGSRSAVGAGGTGTGGAASCCSCCCCCCGRPTRSGRRGRRRGCSPSPGCRWGYQALSVVLLLAQGGLLDLYLIAVTDLYWCSWIATDLVVVVGWAIFFAKNSRGRRGGPANSMHNHHQLHHHSAPPLHLSAAASAGAGAKARGGRGGSGGSGAGPGTTGAAGEFAFAYLAWLIYSIAFTPKVVLILGTSILDLIELRAPFGTTGFRLTMALSVPLLYSLVRAISEAGAPPGSAGPLLLQPQQHRAAGCFLGTCLDLLDSFTLVELMLDGRVPLPAHLRYLLIAVYFLTLASPVLWLYELNTATAAPSWGQTSGPGSCSRLLRLLGGCLVDVPLLALRSLLVVSYQQPLSIFMLKNLFFLGCRGLEALEGCWDRGSWVSPSRARSSYGAPPSAPPPPPPPPPQGGSQRGHLENEGGPHGYVNTLAVASQN

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM121 family


   💬 WhatsApp