CASP7_MOUSE   P97864


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97864

Recommended name:Caspase-7

EC number:EC 3.4.22.60

Alternative names:(CASP-7) (Apoptotic protease Mch-3) (Cysteine protease LICE2)

Cleaved into:Caspase-7 subunit p20; Caspase-7 subunit p11

GeneID:12369

Gene names  (primary ):Casp7

Gene names  (synonym ):Lice2 Mch3

Gene names  (ORF ):

Length:303

Mass:34061

Sequence:MTDDQDCAAELEKVDSSSEDGVDAKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLYRMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR

Tissue specificity:Highly expressed in heart, lung, liver and kidney. Low levels in spleen, skeletal muscle and testis. No expression in the brain.

Induction:

Developmental stage:

Protein families:Peptidase C14A family


   💬 WhatsApp