CS2LA_MOUSE   Q02862


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02862

Recommended name:Alpha-S2-casein-like A

EC number:

Alternative names:(Casein alpha S2-like A) (Gamma-casein) (PP22)

Cleaved into:

GeneID:12993

Gene names  (primary ):Csn1s2a

Gene names  (synonym ):Csng

Gene names  (ORF ):

Length:184

Mass:21101

Sequence:MKFFIFACLVVVALAKHEIKDKSSSEESSASIYPGKSKLDNSVFFQTTKDSASSSSSEESSEEVSEKIVQSEEQKVNLNQQKKFKQFSQESSFSQCCTPLHQQQQSSVNQWPQPNAIHNTPTQESISTSVEEILKKIIDMIKYIQYQQVTIPQLPQALHPQIPVSYWYPSKDYTFPNAHYTRFY

Tissue specificity:Mammary gland-specific. Secreted in milk.

Induction:

Developmental stage:

Protein families:Alpha-casein family


   💬 WhatsApp