MIA_MOUSE Q61865
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61865
Recommended name：Melanoma-derived growth regulatory protein
EC number：
Alternative names：(Cartilage-derived retinoic acid-sensitive protein) (CD-RAP) (Melanoma inhibitory activity protein)
Cleaved into：
GeneID：12587
Gene names (primary )：Mia
Gene names (synonym )：Cdrap Mia1
Gene names (ORF )：
Length：130
Mass：14593
Sequence：MVWSPVLLGIVVLSVFSGPSRADRAMPKLADWKLCADEECSHPISMAVALQDYVAPDCRFLTIYRGQVVYVFSKLKGRGRLFWGGSVQGGYYGDLAARLGYFPSSIVREDLTLKPGKIDMKTDQWDFYCQ
Tissue specificity：All malignant melanoma cell lines tested and infrequently in glioma cell lines.
Induction：
Developmental stage：
Protein families：MIA/OTOR family