CAH8_MOUSE   P28651


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28651

Recommended name:Carbonic anhydrase-related protein

EC number:

Alternative names:(CARP) (Carbonic anhydrase VIII) (CA-VIII)

Cleaved into:

GeneID:12319

Gene names  (primary ):Ca8

Gene names  (synonym ):Cals Cals1 Car8 Carp

Gene names  (ORF ):

Length:291

Mass:33081

Sequence:MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Tissue specificity:Expressed only in Purkinje cells.

Induction:

Developmental stage:

Protein families:Alpha-carbonic anhydrase family


   💬 WhatsApp