CAH11_MOUSE O70354
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70354
Recommended name：Carbonic anhydrase-related protein 11
EC number：
Alternative names：(CA-RP XI) (CA-XI) (CARP XI) (Carbonic anhydrase-related protein 2) (CA-RP II) (CARP-2)
Cleaved into：
GeneID：12348
Gene names (primary )：Ca11
Gene names (synonym )：Car11 Carp2
Gene names (ORF )：
Length：328
Mass：36051
Sequence：MGGAARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGGPHGR
Tissue specificity：
Induction：
Developmental stage：
Protein families：Alpha-carbonic anhydrase family