MCAT_MOUSE Q9Z2Z6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2Z6
Recommended name：Mitochondrial carnitine/acylcarnitine carrier protein
EC number：
Alternative names：(Carnitine/acylcarnitine translocase) (CAC) (mCAC) (Solute carrier family 25 member 20)
Cleaved into：
GeneID：57279
Gene names (primary )：Slc25a20
Gene names (synonym )：Cac Cact
Gene names (ORF )：
Length：301
Mass：33027
Sequence：MADEPKPISPFKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELSYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQASSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKFLNWIAPNL
Tissue specificity：Widely expressed, with highest levels in the liver, intermediate levels in heart, testis and kidney and low levels in brain, including cortex, cerebellum, hippocampus and hypothalamus. {ECO:0000269|PubMed:19287344}.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family