CETN2_MOUSE Q9R1K9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1K9
Recommended name：Centrin-2
EC number：
Alternative names：(Caltractin isoform 1)
Cleaved into：
GeneID：26370
Gene names (primary )：Cetn2
Gene names (synonym )：Calt
Gene names (ORF )：
Length：172
Mass：19797
Sequence：MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
Tissue specificity：Ubiquitously expressed in all adult tissues tested, with strongest expression in brain, spleen, kidney, small intestine and ovary. Also expressed in the NIH 3T3 fibroblast cell line and peripheral blood lymphocytes. {ECO:0000269|PubMed:11250075}.
Induction：
Developmental stage：
Protein families：Centrin family