RCAN2_MOUSE Q9JHG2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHG2
Recommended name：Calcipressin-2
EC number：
Alternative names：(Calcineurin inhibitory protein ZAKI-4) (Down syndrome candidate region 1-like protein 1) (Myocyte-enriched calcineurin-interacting protein 2) (MCIP2) (Regulator of calcineurin 2)
Cleaved into：
GeneID：53901
Gene names (primary )：Rcan2
Gene names (synonym )：Dscr1l1 Zaki4
Gene names (ORF )：
Length：197
Mass：22025
Sequence：MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDECVTFQLFKSFRRVRINFSHPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWKPISDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDMEEEEDPKTSPKPKIIQTRRPGLPPSVSN
Tissue specificity：Highest expression in heart, skeletal muscle and brain. Lower expression in all other tissues.
Induction：
Developmental stage：
Protein families：RCAN family