BTG4_MOUSE   O70552


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70552

Recommended name:Protein BTG4

EC number:

Alternative names:(BTG family member 4) (Protein PC3b)

Cleaved into:

GeneID:56057

Gene names  (primary ):Btg4

Gene names  (synonym ):Pc3b

Gene names  (ORF ):

Length:250

Mass:28613

Sequence:MRDEIATAVFFVTRLVKKHEKLSTQQIETFALKLMTILFEKYRGHWHPDCPSKGQAFRCIRINNNENKDPVLERACAESNVNFFHLGLPKEMTIWVDPYEVCCRYGEKKHPFTIASFKGRWENWELAQHVSCAVNRATGDCSSGTSSDEESCSREAQIIPKVNNPKSVYQVENFKQSLQPWFCLPRRKHLADGRGFLPGAACHPVPKSSKWCRPASRRVDRYHWVNAQLFSGQTAPGEPGEEALSSLKQK

Tissue specificity:Highly expressed in testis and in olfactory epithelium.

Induction:

Developmental stage:

Protein families:BTG family


   💬 WhatsApp