ZBT46_MOUSE   Q8BID6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BID6

Recommended name:Zinc finger and BTB domain-containing protein 46

EC number:

Alternative names:(BTB-ZF protein expressed in effector lymphocytes) (BZEL) (BTB/POZ domain-containing protein 4)

Cleaved into:

GeneID:72147

Gene names  (primary ):Zbtb46

Gene names  (synonym ):Btbd4

Gene names  (ORF ):

Length:600

Mass:65499

Sequence:MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDACVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDELSEFEIGTPASNSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHEGGSSYGKEDQEPKADGPDDVSSQSLWPGDVGYGSLRIKEEQISPSHYGGSELPSSKDTAIQNSLSEQGSGDGWQPTGRRKNRKNKETVRHITQQVEEDSQAGSPVPSFLPTSGWPFSSRDSNVDLTVTEASSLDSRGERAELYAHIDEGLLGGETSYLGPPLTPEKEEALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPKGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIKHGSRRHGVCADCAGRGVGTPLDHGGGGEGSPEALFAGEGPYLEDPDDPRGEAEEELVEDEDEDVAKWKDDVGLAHEDALLGDDKDDEDSPQGPHSPSGEPDKDFAWIS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp