RPF2_MOUSE   Q9JJ80


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJ80

Recommended name:Ribosome production factor 2 homolog

EC number:

Alternative names:(Brix domain-containing protein 1) (Ribosome biogenesis protein RPF2 homolog)

Cleaved into:

GeneID:67239

Gene names  (primary ):Rpf2

Gene names  (synonym ):Bxdc1

Gene names  (ORF ):MNCb-4285

Length:306

Mass:35364

Sequence:MDALDKVLKPKTKRAKRFLEKREPKLTENIKNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKTSKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNGKVYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGTTFGRIHMQKQDLSKLQTRKMKGLKKRPAENGVDDQGKKSKRIKKN

Tissue specificity:

Induction:

Developmental stage:

Protein families:RPF2 family


   💬 WhatsApp