BEX2_MOUSE Q9WTZ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTZ8
Recommended name:Protein BEX2
EC number:
Alternative names:(Brain-expressed X-linked protein 2 homolog)
Cleaved into:
GeneID:12069
Gene names (primary ):Bex2
Gene names (synonym ):
Gene names (ORF ):
Length:129
Mass:15452
Sequence:MESKVEQGVKNLNMENDHQEKEEKEEKPQDASKRDPIVALPFEAGDYYVPRGGRRRFRVRQPIVHYRWDLMHRVGEPQGRMREENVQRFGDDVRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP
Tissue specificity:Primarily localized to neuronal cells within several regions of the brain, including the olfactory epithelium, bulb, peri/paraventricular nuclei, suprachiasmatic nucleus, arcuate nucleus, median eminence, lateral hypothalamic area, thalamus, hippocampus and cerebellum (at protein level). {ECO:0000269|PubMed:15861462}.
Induction:
Developmental stage:
Protein families:BEX family