PIANP_MOUSE Q6P1B3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P1B3
Recommended name：PILR alpha-associated neural protein
EC number：
Alternative names：(Brain protein 1) (PILR-associating neural protein) (Paired immunoglobin-like type 2 receptor-associating neural protein)
Cleaved into：
GeneID：319352
Gene names (primary )：Pianp
Gene names (synonym )：Panp
Gene names (ORF )：
Length：278
Mass：29744
Sequence：MWSAQLLSQLLPLWPLLLLSVLPPAQGSSHRSPPAPARPPCVRGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVVPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSVNPGFLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPQPKGAPAFQLNRIPLVNL
Tissue specificity：Mainly expressed in brain and spinal cord. Weak expression also detected in heart, kidney, spleen and lymph node. Virtually no expression detected in liver and embryo relative to brain. {ECO:0000269|PubMed:21241660}.
Induction：
Developmental stage：
Protein families：