CLD5_MOUSE   O54942


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54942

Recommended name:Claudin-5

EC number:

Alternative names:(Brain endothelial cell clone 1 protein) (Lung-specific membrane protein)

Cleaved into:

GeneID:12741

Gene names  (primary ):Cldn5

Gene names  (synonym ):Bec1

Gene names  (ORF ):

Length:218

Mass:23054

Sequence:MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV

Tissue specificity:Widely expressed with highest levels in the lung. {ECO:0000269|PubMed:9892664}.

Induction:

Developmental stage:

Protein families:Claudin family


   💬 WhatsApp