BSPH1_MOUSE   Q3UW26


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UW26

Recommended name:Binder of sperm protein homolog 1

EC number:

Alternative names:(Bovine seminal plasma protein homolog 1) (Bovine seminal plasma protein-like 1)

Cleaved into:

GeneID:330470

Gene names  (primary ):Bsph1

Gene names  (synonym ):Gm767

Gene names  (ORF ):

Length:133

Mass:16014

Sequence:MAQPLDFLLVSICLFHSLFSFQVEDYYAPTIESLIRNPETEDGACVFPFLYRSEIFYDCVNFNLKHKWCSLNKTYQGYWKYCALSDYAPCAFPFWYRHMIYWDCTEDGEVFGKKWCSLTPNYNKDQVWKYCIE

Tissue specificity:Expressed only in the epididymis. {ECO:0000269|PubMed:17085770}.

Induction:

Developmental stage:

Protein families:Seminal plasma protein family


   💬 WhatsApp