CEND_MOUSE Q9JKC6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKC6
Recommended name：Cell cycle exit and neuronal differentiation protein 1
EC number：
Alternative names：(BM88 antigen)
Cleaved into：
GeneID：57754
Gene names (primary )：Cend1
Gene names (synonym )：Bm88
Gene names (ORF )：
Length：149
Mass：14987
Sequence：MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDTQAEKQEQAAAPGPAATKKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDATSEPKGPGDGAEEDESNTGGRGPWPCENLTPLLVAGGVAVATIALILGVAFLARKK
Tissue specificity：Expressed in the brain, including hypothalamus, brainstem, and hippocampus. Expression is high in 1-month-old mouse brain and then declines in mature mouse brains at the age of 3 and 7 months. {ECO:0000269|PubMed:23658157}.
Induction：
Developmental stage：
Protein families：CEND1 family