KCMB4_MOUSE Q9JIN6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JIN6
Recommended name：Calcium-activated potassium channel subunit beta-4
EC number：
Alternative names：(BK channel subunit beta-4) (BKbeta4) (Calcium-activated potassium channel, subfamily M subunit beta-4) (Charybdotoxin receptor subunit beta-4) (K(VCA)beta-4) (Maxi K channel subunit beta-4) (Slo-beta-4)
Cleaved into：
GeneID：58802
Gene names (primary )：Kcnmb4
Gene names (synonym )：
Gene names (ORF )：
Length：210
Mass：23857
Sequence：MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQDLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQHQLLTNPKCSYIPPCKRENQKNSESVMNWQQYWKDEIGSQPFTCYFNQHQRPEDVLLQRTHDEIALLHCFLWPVVAFVVGVLIVVLTICAKSLAVKAEAMKKRKFS
Tissue specificity：
Induction：
Developmental stage：
Protein families：KCNMB (TC 8.A.14.1) family, KCNMB4 subfamily