KCMB1_MOUSE Q8CAE3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CAE3
Recommended name:Calcium-activated potassium channel subunit beta-1
EC number:
Alternative names:(BK channel subunit beta-1) (BKbeta) (BKbeta1) (Calcium-activated potassium channel, subfamily M subunit beta-1) (Calcium-activated potassium channel subunit beta) (Charybdotoxin receptor subunit beta-1) (K(VCA)beta-1) (Maxi K channel subunit beta-1) (Slo-beta-1) (Slo-beta)
Cleaved into:
GeneID:16533
Gene names (primary ):Kcnmb1
Gene names (synonym ):
Gene names (ORF ):
Length:191
Mass:21846
Sequence:MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLLLIAMVKLNRSLSILAAQK
Tissue specificity:Expressed in many tissues containing smooth muscles. In brain and heart, it is not expressed except in the vasculature, such as cerebral arteries, aorta and corona arteries. {ECO:0000269|PubMed:11057658}.
Induction:
Developmental stage:
Protein families:KCNMB (TC 8.A.14.1) family, KCNMB1 subfamily