SNAPN_MOUSE Q9Z266
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z266
Recommended name：SNARE-associated protein Snapin
EC number：
Alternative names：(Biogenesis of lysosome-related organelles complex 1 subunit 7) (BLOC-1 subunit 7) (Synaptosomal-associated protein 25-binding protein) (SNAP-associated protein)
Cleaved into：
GeneID：20615
Gene names (primary )：Snapin
Gene names (synonym )：Bloc1s7 Snap25bp Snapap
Gene names (ORF )：
Length：136
Mass：14904
Sequence：MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK
Tissue specificity：Strongly expressed in heart, brain, testis, kidney and liver; low expression in spleen, lung and skeletal muscle. In the testis, expressed in the seminiferous tubules. {ECO:0000269|PubMed:12877659, ECO:0000269|PubMed:19168546}.
Induction：
Developmental stage：
Protein families：SNAPIN family