K1B22_MOUSE P15948
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15948
Recommended name：Kallikrein 1-related peptidase b22
EC number：EC 3.4.21.35
Alternative names：(Beta-NGF-endopeptidase) (Epidermal growth factor-binding protein type A) (EGF-BP A) (Glandular kallikrein K22) (mGK-22) (Nerve growth factor beta chain endopeptidase) (Tissue kallikrein 22)
Cleaved into：
GeneID：13646
Gene names (primary )：Klk1b22
Gene names (synonym )：Klk-22 Klk22
Gene names (ORF )：
Length：259
Mass：28384
Sequence：MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily