HBBZ_MOUSE   P04444


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P04444

Recommended name:Hemoglobin subunit beta-H1

EC number:

Alternative names:(Beta-H1-globin) (Hemoglobin beta-H1 chain) (Protein Z)

Cleaved into:

GeneID:15132

Gene names  (primary ):Hbb-bh1

Gene names  (synonym ):

Gene names  (ORF ):

Length:147

Mass:16494

Sequence:MVHFTAEEKAAITSIWDKVDLEKVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPRIRAHGKKVLTSLGLGVKNMDNLKETFAHLSELHCDKLHVDPENFKLLGNMLVIVLSTHFAKEFTPEVQAAWQKLVIGVANALSHKYH

Tissue specificity:Red blood cells.

Induction:

Developmental stage:

Protein families:Globin family


   💬 WhatsApp