MRGRD_MOUSE Q91ZB8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZB8
Recommended name：Mas-related G-protein coupled receptor member D
EC number：
Alternative names：(Beta-alanine receptor) (G-protein coupled receptor TGR7)
Cleaved into：
GeneID：211578
Gene names (primary )：Mrgprd
Gene names (synonym )：Gm499 Mrgd
Gene names (ORF )：
Length：321
Mass：36126
Sequence：MNSTLDSSPAPGLTISPTMDLVTWIYFSVTFLAMATCVGGMAGNSLVIWLLSCNGMQRSPFCVYVLNLAVADFLFLFCMASMLSLETGPLLIVNISAKIYEGMRRIKYFAYTAGLSLLTAISTQRCLSVLFPIWYKCHRPRHLSSVVSGALWALAFLMNFLASFFCVQFWHPNKHQCFKVDIVFNSLILGIFMPVMILTSTILFIRVRKNSLMQRRRPRRLYVVILTSILVFLTCSLPLGINWFLLYWVDVKRDVRLLYSCVSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRALRDEPEPEGRETPSTCTNDGV
Tissue specificity：Expressed in a subset of sensory neurons that includes nociceptors. Expressed in the subclass of non-peptidergic sensory neurons that are IB4(+) and VR1(-). {ECO:0000269|PubMed:11551509}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family, Mas subfamily