TPPC3_MOUSE   O55013


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55013

Recommended name:Trafficking protein particle complex subunit 3

EC number:

Alternative names:(BET3 homolog)

Cleaved into:

GeneID:27096

Gene names  (primary ):Trappc3

Gene names  (synonym ):Bet3

Gene names  (ORF ):

Length:180

Mass:20302

Sequence:MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSALIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE

Tissue specificity:Widely expressed. Expressed in lung, heart, liver, spleen, brain and kidney. {ECO:0000269|PubMed:16828797}.

Induction:

Developmental stage:

Protein families:TRAPP small subunits family, BET3 subfamily


   💬 WhatsApp